DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and dpr9

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:317 Identity:124/317 - (39%)
Similarity:178/317 - (56%) Gaps:60/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PYFDNSSRREVTATVGQAALLHCRVRNLGDRA----VSWIRKRDLHILTVGILTYTNDQRFQSLH 105
            ||||.:..:.|||.:|:.|.|:|||:|||::.    |||:|.||:|:||||..|||:||||:::|
  Fly   256 PYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIH 320

  Fly   106 SEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTC 170
            ...:::|.|:|..||.||||.|||||||.|.:|....||||....:|:|..:|:|:|||.|||||
  Fly   321 QPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDLYIESGSTINLTC 385

  Fly   171 LAMQSPVPPSFIYWYKGK------RVMNY-SQRGGINVITER-STRTSKLLIAKATPADSGNYTC 227
            :...||.||::|:|....      :::|| |.|||::|:|.: .|.||.|||..|.|:|||:|.|
  Fly   386 IIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHYQC 450

  Fly   228 SPSSSDSASVVVHVING-EHPAAMQHGNSSATCLRPLSSTS---------VPFVL------ATWM 276
            :||::...||.|||:|| .|  ::..|..|:...|..|::|         ||..:      ..|:
  Fly   451 NPSNAKPKSVTVHVLNGVSH--SVSRGVPSSNAARGTSASSPLAHSLSVCVPVCVLLQLGACRWI 513

  Fly   277 SMTV-ASVAWNSNLN-----------------------------INWNWSPDWRWHW 303
            :..: |::|....|.                             :.|.|...|||||
  Fly   514 AALLGAALATPPPLRSTRRATGERPGSPGCAPIACDMRHFLASVLRWQWRWCWRWHW 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 51/96 (53%)
IG_like 53..145 CDD:214653 50/95 (53%)
ig 153..227 CDD:278476 37/81 (46%)
IG_like 161..>227 CDD:214653 34/73 (47%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 51/97 (53%)
IG_like 263..360 CDD:214653 50/96 (52%)
IG_like 371..464 CDD:214653 42/92 (46%)
IGc2 377..456 CDD:197706 37/78 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444739
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105520
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
98.790

Return to query results.
Submit another query.