DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and NEGR1

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:364 Identity:72/364 - (19%)
Similarity:126/364 - (34%) Gaps:135/364 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGD 74
            |...||:|       .|...|..|     :.|::.  .||...|:     |..|:|.|.:.: |.
Human    22 LSLCCLLP-------SCLPAGQSV-----DFPWAA--VDNMMVRK-----GDTAVLRCYLED-GA 66

  Fly    75 RAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE--PKI 137
            ...:|:.:..  |:..|...::.|.|. |:.:....:::|:|.:....|.|.|.|.|.|:  |:.
Human    67 SKGAWLNRSS--IIFAGGDKWSVDPRV-SISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRT 128

  Fly   138 SQGFRLNVVVSRAKI--LGNAELFIKSGSDINLTCLAMQSP------------------------ 176
            .| ..|.|.|. .||  :.| ::.:..|:::.|||||...|                        
Human   129 MQ-VHLTVQVP-PKIYDISN-DMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDI 190

  Fly   177 -----------------------------------------------------------VPPSFI 182
                                                                       |||...
Human   191 YGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAF 255

  Fly   183 YWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSS---SDSASVVVHVING 244
            .||||::.:...|:|   :|.:..:..|.|.:...|....|||||..::   :.:||:.::    
Human   256 EWYKGEKKLFNGQQG---IIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLN---- 313

  Fly   245 EHPAAMQHGNSSATCLRPLSSTSVPFVLATW-MSMTVAS 282
             .|:..|:|.:.          |...:.:.| :.:|::|
Human   314 -PPSTAQYGITG----------SADVLFSCWYLVLTLSS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 23/94 (24%)
IG_like 53..145 CDD:214653 23/93 (25%)
ig 153..227 CDD:278476 24/156 (15%)
IG_like 161..>227 CDD:214653 23/148 (16%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 24/97 (25%)
IGc2 152..210 CDD:197706 7/57 (12%)
Ig_3 225..301 CDD:372822 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.