DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and Tyro3

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_058788.1 Gene:Tyro3 / 25232 RGDID:3923 Length:880 Species:Rattus norvegicus


Alignment Length:253 Identity:60/253 - (23%)
Similarity:100/253 - (39%) Gaps:55/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEW--TLRI 116
            ::|.:.||...|:|.|..:.|..:.|::.        |.:.....|...|:..:   .|  .|.:
  Rat    41 KMTVSQGQPVKLNCSVEGMDDPDIHWMKD--------GAVVQNASQVSISISEQ---NWIGLLSL 94

  Fly   117 SSPQPRDSGTYECQV--STEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPP 179
            .|.:..|:|.|.|||  ..|.||||...|.|.......:...:|.:.......|:|.|:..|.|.
  Rat    95 KSAERSDAGLYWCQVKDGEETKISQSVWLTV
EGVPFFTVEPKDLAVPPNVPFQLSCEAVGPPEPV 159

  Fly   180 SFIYWYKGKRVMNYSQRGG-------INV--ITER-------------STRTSKLLIAKATPADS 222
            : |:|::|.     ::.||       :||  :|:|             :|....::..:|.||..
  Rat   160 T-IFWWRGP-----TKVGGPASSPSVLNVTGVTQRTEFSCEAHNIKGLATSRPAIIRLQAPPAAP 218

  Fly   223 GNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTV 280
            .|.|.:..||.:|||.  .:.|....|:.|     :|     :..|......|.::.|
  Rat   219 FNITVTTISSSNASVA--WVPGADGLALLH-----SC-----TVQVAHAPGEWEALAV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 26/95 (27%)
IG_like 53..145 CDD:214653 26/94 (28%)
ig 153..227 CDD:278476 20/95 (21%)
IG_like 161..>227 CDD:214653 19/87 (22%)
Tyro3NP_058788.1 IG_like 39..125 CDD:214653 26/94 (28%)
IGc2 46..111 CDD:197706 19/75 (25%)
Ig2_Tyro3_like 131..209 CDD:143226 16/83 (19%)
IG_like 135..204 CDD:214653 15/74 (20%)
FN3 215..307 CDD:238020 16/62 (26%)
fn3 315..396 CDD:278470
PTKc_Tyro3 498..781 CDD:270659
Pkinase_Tyr 508..776 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..827
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.