DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:310 Identity:68/310 - (21%)
Similarity:120/310 - (38%) Gaps:90/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKR 83
            |:.|.::       .||.:.|||   |.:       :.|..|.:..:.|.........|:|:::.
Mouse   132 WVHLTIN-------APPTFTETP---PQY-------IEAKEGGSITMTCTAFGNPKPIVTWLKEG 179

  Fly    84 DLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQ--------VSTEPKISQG 140
            .|    :|.     ..::|.  |:||    |.::|....|.|.|.|:        |.|...:.||
Mouse   180 TL----LGA-----SAKYQV--SDGS----LTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQG 229

  Fly   141 --FRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRG---GIN 200
              |    :||..:     .:.:....|..|||.|...|...::.::::.:.|  |.|..   .:.
Mouse   230 PPF----IVSPPE-----NITVNISQDALLTCRAEAYPGNLTYTWYWQDENV--YFQNDLKLRVR 283

  Fly   201 VITERSTRTSKLLIAKATPADSGNYTCSPSS----SDSASVVVHVINGEHPAAMQHGNSSATCLR 261
            ::.:     ..|:|.:..|.|:|.|||.||:    |.|||..:.|   ::||.:.:       :.
Mouse   284 ILID-----GTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTV---QYPARVLN-------MP 333

  Fly   262 PLSSTSVPFVLATWMSMTVAS------VAWNSN-------LNINWNWSPD 298
            |:  ..||..:..::...|.:      |.||.:       .|:.|....|
Mouse   334 PV--IYVPVGIHGYIRCPVDAEPPATVVKWNKDGRPLQVEKNLGWTLMED 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 22/102 (22%)
IG_like 53..145 CDD:214653 22/101 (22%)
ig 153..227 CDD:278476 15/76 (20%)
IG_like 161..>227 CDD:214653 15/68 (22%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462 24/110 (22%)
Ig 231..323 CDD:386229 26/107 (24%)
Ig <355..416 CDD:386229 6/27 (22%)
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.