| Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
| Alignment Length: | 346 | Identity: | 78/346 - (22%) |
|---|---|---|---|
| Similarity: | 118/346 - (34%) | Gaps: | 128/346 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 43 SQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSE 107
Fly 108 GSDEWTLRISSPQPRDSGTYECQVST--EPKISQGFRLNVVVSRAKILG-NAELFIKSGSDINLT 169
Fly 170 CLAMQSP---------------------------------------------------------- 176
Fly 177 ------------------------VPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKA 217
Fly 218 TPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSAT--CLRPLS-STSVPFVLATWMSMT 279
Fly 280 VASVAWNSNLNINWNWSPDWR 300 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 24/94 (26%) |
| IG_like | 53..145 | CDD:214653 | 24/93 (26%) | ||
| ig | 153..227 | CDD:278476 | 28/156 (18%) | ||
| IG_like | 161..>227 | CDD:214653 | 28/147 (19%) | ||
| Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 24/93 (26%) |
| Ig strand A' | 41..46 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 61..68 | CDD:409353 | 3/7 (43%) | ||
| Ig strand C | 61..67 | CDD:409353 | 3/6 (50%) | ||
| CDR2 | 69..79 | CDD:409353 | 3/11 (27%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 2/2 (100%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 10/35 (29%) | ||
| Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 120..129 | CDD:409353 | 2/10 (20%) | ||
| FR4 | 122..129 | CDD:409353 | 1/8 (13%) | ||
| Ig strand A | 132..137 | CDD:409353 | 2/4 (50%) | ||
| Ig_3 | 134..199 | CDD:404760 | 8/64 (13%) | ||
| Ig strand A' | 140..145 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 148..157 | CDD:409353 | 4/8 (50%) | ||
| Ig strand C | 163..167 | CDD:409353 | 0/3 (0%) | ||
| Ig strand D | 174..177 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 178..183 | CDD:409353 | 0/4 (0%) | ||
| Ig strand F | 191..199 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 217..295 | CDD:404760 | 24/98 (24%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 234..238 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 288..293 | CDD:409353 | 4/23 (17%) | ||
| Ig strand G | 301..304 | CDD:409353 | 2/2 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||