DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and zig-4

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:168 Identity:40/168 - (23%)
Similarity:64/168 - (38%) Gaps:28/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 NVVVSRAKILGNAEL---FIKSGSDINLTCLAMQSPVPPSFIYW-YKGKRVMNYSQRGGINV--- 201
            |.:.|.|||...|.|   .|..|....|.|..|.:|.  :.|:| :.||.:...::   :||   
 Worm    38 NYLTSPAKIKIVAPLESALIPGGETYQLRCDIMSTPA--ATIHWKFNGKLIQGSNE---LNVEEK 97

  Fly   202 -------ITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSATC 259
                   |.:.....|.|.|...:..:||.|:|...:.......|..:..|       |.:|...
 Worm    98 LLNFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNGHQTIETVAEVEIE-------GEASGCR 155

  Fly   260 LRPLSSTSVPFVLATWMSMT--VASVAWNSNLNINWNW 295
            ....|:..:.|...:...||  ||::...:|..::|.|
 Worm   156 SNHKSAPEIVFWTDSRFEMTGNVATLVCRANQQVDWVW 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 1/1 (100%)