DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and rig-3

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:253 Identity:51/253 - (20%)
Similarity:80/253 - (31%) Gaps:85/253 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YSQPYFDNSSRREVTATVGQA--ALLHCRVRNL-----------GDRAVSWIRKRDLHILTVGIL 93
            |:.|.|:.....:.|......  |:::|.|.:.           ||..:....|.::.: .||: 
 Worm   244 YTLPEFETEESVQYTVIDNHVRDAIIYCNVTHSFPPVRHYTFYHGDEEIKMSDKFNIFV-NVGV- 306

  Fly    94 TYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVS------------------TEPKIS-- 138
                        |:|:.   |:|.:....|.|||:|:.:                  .|||::  
 Worm   307 ------------SQGAH---LKIHNVNENDLGTYKCEANNIKAKSYHTIHLREANAPAEPKVTLI 356

  Fly   139 -----------------QGFRLNVVVSRAKILGNAELFIKSGSDIN-----LTCLAMQSPVPPSF 181
                             ....:..|..|....|.||....|..||:     ...:.||..:....
 Worm   357 EDKRHSIIWKVESIDRDPDLPMTAVEIRHLRAGTAEASGVSDEDISDAYWKSHSIFMQRNIKDDG 421

  Fly   182 IYWYKGKR-----VMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSSSDS 234
            ||...|.|     |..:.|      |.|.....|.:|.||.  .|..:.....|:|||
 Worm   422 IYEINGLRHGHEYVWRFRQ------INEAGFGDSVVLRAKT--LDDHDLEMMDSASDS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 21/142 (15%)
IG_like 53..145 CDD:214653 21/141 (15%)
ig 153..227 CDD:278476 21/83 (25%)
IG_like 161..>227 CDD:214653 18/75 (24%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653
Ig 267..341 CDD:319273 17/90 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.