DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and Papln

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001192272.1 Gene:Papln / 170721 MGIID:2386139 Length:1302 Species:Mus musculus


Alignment Length:360 Identity:79/360 - (21%)
Similarity:108/360 - (30%) Gaps:151/360 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GEVPPH---YWETPYSQ------PYFDNSSRRE--------------------VTATVGQAALLH 66
            || |||   |...|..|      |..|..:|..                    |.|..|||..|.
Mouse   884 GE-PPHIPAYGNRPGGQEIRPRVPGLDREARPAVPPTHSPSYRIRLAGSEPSLVQAAPGQAVQLF 947

  Fly    67 CRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYEC-- 129
            |......:....| :|....|         :..|:| |.::||    |.||..:|.|:|.|.|  
Mouse   948 CPGNIPSEFQAGW-QKEGRPI---------SSNRYQ-LQADGS----LIISRLRPEDAGIYSCGS 997

  Fly   130 -QVSTEPKISQGFRLNVV----------------VSRAKILGNAELFIKSGSD------------ 165
             :...||   |..:|.|.                ..|...||:......:|::            
Mouse   998 HRPGHEP---QEIQLRVTGGDMAVFPEGQPRHFPEPRNPDLGHGPPHRGTGAEAGGHRVLSPSHP 1059

  Fly   166 -----------------------INLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERS- 206
                                   |.|||.|...|||.  |.|          ||.|..|.:.|. 
Mouse  1060 RPATRLRLDRTQPGVVDASPGQRIRLTCRAEGFPVPT--IEW----------QRDGQLVSSPRHQ 1112

  Fly   207 -TRTSKLLIAKATPADSGNYTC---SPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTS 267
             .....|:|::....|.|.|:|   :....|...|.:.|                  ||.|:.|.
Mouse  1113 VQPDGSLVISRVDVEDGGYYSCVAFNGQDRDQRWVQLRV------------------LRELTITG 1159

  Fly   268 VPFVLATWMSMTVAS--------VAWNSNLNINWN 294
            :|      .::|||.        |....::||.|:
Mouse  1160 LP------PAVTVAEGDTARLLCVVAGESVNIRWS 1188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 27/115 (23%)
IG_like 53..145 CDD:214653 27/114 (24%)
ig 153..227 CDD:278476 23/110 (21%)
IG_like 161..>227 CDD:214653 21/102 (21%)
PaplnNP_001192272.1 TSP1 30..81 CDD:214559
ADAM_spacer1 184..299 CDD:368694
TSP1 309..362 CDD:214559
TSP1 389..447 CDD:214559
TSP1 447..504 CDD:214559
TSP1 511..562 CDD:214559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..648
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..737
Kunitz_BPTI 771..822 CDD:333766
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 822..924 11/40 (28%)
Papilin_u7 831..922 CDD:374683 11/38 (29%)
Ig 932..>995 CDD:386229 22/77 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1024..1064 4/39 (10%)
I-set 1070..1141 CDD:369462 21/82 (26%)
Ig 1157..1241 CDD:386229 9/38 (24%)
PLAC 1257..1289 CDD:370061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.