DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and Dscam

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus


Alignment Length:267 Identity:65/267 - (24%)
Similarity:108/267 - (40%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEG 108
            ||.....|.|:|.::||....|.|.|....|:.:||.|..:  ||..|          :::...|
Mouse   312 QPLKATISPRKVKSSVGSQVSLSCSVTGNEDQELSWYRNGE--ILNPG----------KNVRITG 364

  Fly   109 SDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV--SRAKILGN-AELFIKSGSDINLTC 170
            .:...|.:......|.|.|:|.|..: |:|....:.||:  ...||:.. :|..:.....::|.|
Mouse   365 LNHANLIMDHMVKSDGGAYQCFVRKD-KLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSLVC 428

  Fly   171 LAMQSPVPPSFIYWY---------KGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYT 226
            ....:|:|.  :.|.         .|.|:   ||     :||......|.|.|:.:...|.|.|.
Mouse   429 NVKGTPLPT--VTWTLDDDPILKGSGHRI---SQ-----MITSEGNVVSYLNISSSQVRDGGVYR 483

  Fly   227 CSPSSSDSASVVVHV--INGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMTVA-----SVA 284
            |  ::::||.||::.  ||...||:          :||:.:.:......|::...|.     |:.
Mouse   484 C--TANNSAGVVLYQARINVRGPAS----------IRPMKNITAIAGRDTYIHCRVIGYPYYSIK 536

  Fly   285 WNSNLNI 291
            |..|.|:
Mouse   537 WYKNANL 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 23/92 (25%)
IG_like 53..145 CDD:214653 23/91 (25%)
ig 153..227 CDD:278476 18/83 (22%)
IG_like 161..>227 CDD:214653 17/74 (23%)
DscamXP_006522949.1 Ig 15..115 CDD:386229
IGc2 239..300 CDD:197706
IG 320..400 CDD:214652 23/92 (25%)
Ig_3 410..488 CDD:372822 19/89 (21%)
IGc2 518..575 CDD:197706 6/26 (23%)
Ig 596..686 CDD:386229
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:386229
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1301..1363 CDD:372822
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.