Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017450901.1 | Gene: | Opcml / 116597 | RGDID: | 620635 | Length: | 354 | Species: | Rattus norvegicus |
Alignment Length: | 372 | Identity: | 78/372 - (20%) |
---|---|---|---|
Similarity: | 129/372 - (34%) | Gaps: | 141/372 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 KAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDR 75
Fly 76 A--VSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE--PK 136
Fly 137 ISQGFRLNVVVSRAKILGN--AELFIKSGSDINLTCLAMQSPVPPSFIYW--------------- 184
Fly 185 -----------------------------YKGKRVMNY--------------SQRG--------- 197
Fly 198 -------------------GINVITERSTRTSKLLIAKATPADSGNYTCSPSS---SDSASVVVH 240
Fly 241 VINGEH----PAAMQHGNSSAT----CLRPLSSTSVPFVLATWMSMT 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 27/96 (28%) |
IG_like | 53..145 | CDD:214653 | 27/95 (28%) | ||
ig | 153..227 | CDD:278476 | 25/161 (16%) | ||
IG_like | 161..>227 | CDD:214653 | 24/151 (16%) | ||
Opcml | XP_017450901.1 | Ig | 44..132 | CDD:416386 | 28/101 (28%) |
Ig strand A' | 44..49 | CDD:409353 | 3/9 (33%) | ||
Ig strand B | 51..59 | CDD:409353 | 3/10 (30%) | ||
CDR1 | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 64..70 | CDD:409353 | 2/5 (40%) | ||
Ig strand C | 64..70 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 71..83 | CDD:409353 | 3/13 (23%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/5 (20%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 8/34 (24%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 4/11 (36%) | ||
FR4 | 125..132 | CDD:409353 | 2/9 (22%) | ||
Ig_3 | 135..206 | CDD:404760 | 10/72 (14%) | ||
Ig strand A | 135..138 | CDD:409353 | 0/2 (0%) | ||
Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 151..160 | CDD:409353 | 4/8 (50%) | ||
Ig strand C | 165..170 | CDD:409353 | 1/6 (17%) | ||
Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 198..206 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 223..300 | CDD:404760 | 13/78 (17%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 0/5 (0%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 293..298 | CDD:409353 | 4/4 (100%) | ||
Ig strand G | 306..309 | CDD:409353 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |