DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and Opcml

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:372 Identity:78/372 - (20%)
Similarity:129/372 - (34%) Gaps:141/372 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDR 75
            |.:.:|.|.||..:..|     ||....:..:.:. .||     ||...|::|.|.|   .:.||
  Rat    12 KCLVVVSLRLLFLVPTG-----VPVRSGDATFPKA-MDN-----VTVRQGESATLRC---TIDDR 62

  Fly    76 A--VSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE--PK 136
            .  |:|:.:..  ||..|...::.|.|...|.:..: ::::.|.:....|.|.|.|.|.|:  ||
  Rat    63 VTRVAWLNRST--ILYAGNDKWSIDPRVIILVNTPT-QYSIMIQNVDVYDEGPYTCSVQTDNHPK 124

  Fly   137 ISQGFRLNVVVSRAKILGN--AELFIKSGSDINLTCLAMQSPVPPSFIYW--------------- 184
            .|   |::::|.....:.|  :::.:..||.:.|.|||:..|.|.  :.|               
  Rat   125 TS---RVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPT--VTWRHLSVKEGQGFVSED 184

  Fly   185 -----------------------------YKGKRVMNY--------------SQRG--------- 197
                                         .|.|..:||              .|:|         
  Rat   185 EYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAV 249

  Fly   198 -------------------GINVITERSTRTSKLLIAKATPADSGNYTCSPSS---SDSASVVVH 240
                               |:.:  |...|.|.|.....:..|.|||||..::   :.:||:.::
  Rat   250 PMAEFQWFKEDTRLATGLDGVRI--ENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLY 312

  Fly   241 VINGEH----PAAMQHGNSSAT----CLRPLSSTSVPFVLATWMSMT 279
            .|:...    |.|:..|.:||:    ||              |:|.|
  Rat   313 EISPSSAVAGPGAVIDGVNSASRALACL--------------WLSGT 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 27/96 (28%)
IG_like 53..145 CDD:214653 27/95 (28%)
ig 153..227 CDD:278476 25/161 (16%)
IG_like 161..>227 CDD:214653 24/151 (16%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 28/101 (28%)
Ig strand A' 44..49 CDD:409353 3/9 (33%)
Ig strand B 51..59 CDD:409353 3/10 (30%)
CDR1 59..63 CDD:409353 1/3 (33%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 3/13 (23%)
Ig strand C' 72..76 CDD:409353 1/5 (20%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 8/34 (24%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 4/11 (36%)
FR4 125..132 CDD:409353 2/9 (22%)
Ig_3 135..206 CDD:404760 10/72 (14%)
Ig strand A 135..138 CDD:409353 0/2 (0%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 4/8 (50%)
Ig strand C 165..170 CDD:409353 1/6 (17%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 0/7 (0%)
Ig_3 223..300 CDD:404760 13/78 (17%)
putative Ig strand A 224..230 CDD:409353 0/5 (0%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 4/4 (100%)
Ig strand G 306..309 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.