DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and LOC108191960

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_021328315.1 Gene:LOC108191960 / 108191960 -ID:- Length:297 Species:Danio rerio


Alignment Length:257 Identity:58/257 - (22%)
Similarity:98/257 - (38%) Gaps:70/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRN---LGDRAVSWIR--KRDL-HILTVGILTYTNDQ---RFQSLHSEG-- 108
            :.|.:|.:.:|.|.|..   |....|.|.|  |.:| |:...|     .|:   ::||.....  
Zfish    28 LVAQLGSSMILPCFVETPLPLDVLEVEWKRTDKEELVHLFQNG-----EDKPEAQYQSYRGRAGF 87

  Fly   109 ------SDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAE-LFIKSGSDI 166
                  ...::|.:.:....|:|:|:|.|.:..::.:.:.....|.|..:.|..: ||.:.|.|:
Zfish    88 FSEQVLKGNFSLLLENITVADAGSYKCVVYSYLEVGETYVTIQYVERVVVTGEDQILFARVGEDV 152

  Fly   167 NLTCLAMQSPVPPSF---IYWYK-GKR-----VMNYSQRGGINVITERSTR-------------- 208
            .|.|: :.|.:||..   :.|.| .||     |:.: |.|  .::|..|.|              
Zfish   153 VLNCM-VDSHIPPEHFDEVSWKKMDKRSDIIPVLLF-QNG--TILTGSSDRFYRDRVEFFREQFP 213

  Fly   209 --TSKLLIAKATPADSGNYTC---SPSSSDSASVVV------------HVINGEHPAAMQHG 253
              ...:.:.....||.|.|.|   :..|..||:|.:            .:..|   ||:|.|
Zfish   214 KGNFSMRLKNVQTADKGKYICEVHTEYSVRSATVEIGQLGKLIDKSIHEMFRG---AAIQRG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 22/107 (21%)
IG_like 53..145 CDD:214653 22/106 (21%)
ig 153..227 CDD:278476 24/99 (24%)
IG_like 161..>227 CDD:214653 21/90 (23%)
LOC108191960XP_021328315.1 Ig 37..127 CDD:325142 20/94 (21%)
Ig 156..239 CDD:325142 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.