Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004916061.1 | Gene: | ntm / 100492453 | XenbaseID: | XB-GENE-6045425 | Length: | 374 | Species: | Xenopus tropicalis |
Alignment Length: | 315 | Identity: | 64/315 - (20%) |
---|---|---|---|
Similarity: | 107/315 - (33%) | Gaps: | 123/315 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSP 119
Fly 120 QPRDSGTYECQVSTE--PKISQGFRLNVVVS-RAKILG-NAELFIKSGSDINLTCLAMQSPVP-- 178
Fly 179 ------------------------------------------------------PSFI------- 182
Fly 183 ---------------------YWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYT 226
Fly 227 C-----------------------SPSSSDSASVVVHVINGEHPAAMQHGNSSAT 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 29/92 (32%) |
IG_like | 53..145 | CDD:214653 | 29/91 (32%) | ||
ig | 153..227 | CDD:278476 | 22/158 (14%) | ||
IG_like | 161..>227 | CDD:214653 | 22/149 (15%) | ||
ntm | XP_004916061.1 | Ig | 45..133 | CDD:299845 | 29/93 (31%) |
IG_like | 45..133 | CDD:214653 | 29/93 (31%) | ||
IG_like | 143..220 | CDD:214653 | 7/76 (9%) | ||
IGc2 | 150..209 | CDD:197706 | 7/58 (12%) | ||
ig | 227..311 | CDD:278476 | 15/86 (17%) | ||
IG_like | 230..311 | CDD:214653 | 15/83 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |