DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and ntm

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:315 Identity:64/315 - (20%)
Similarity:107/315 - (33%) Gaps:123/315 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSP 119
            ||...|.:|:|.|.|.|...| |:|:.:..  ||..|...::.|.|...|.:..| ::::.|.:.
 Frog    46 VTVRQGDSAILRCTVDNRVTR-VAWLNRST--ILYTGNDKWSIDPRVVLLANTKS-QYSIEIQNV 106

  Fly   120 QPRDSGTYECQVSTE--PKISQGFRLNVVVS-RAKILG-NAELFIKSGSDINLTCLAMQSPVP-- 178
            ...|.|.|.|.|.|:  ||.|   |::::|. ..:|:. ::.:.:..||:::|.|:|...|.|  
 Frog   107 DIYDEGPYTCSVQTDNHPKTS---RVHLIV
QVPPRIVDISSSIAVNEGSNVSLICIANGRPEPVV 168

  Fly   179 ------------------------------------------------------PSFI------- 182
                                                                  |.:|       
 Frog   169 NWRYLSPKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRRVKLTVNYPPYILDAQNIG 233

  Fly   183 ---------------------YWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYT 226
                                 :|||..:.::.|.||   |..|.....|::.....:..|.||||
 Frog   234 APLGHRGILQCEASAVPAADFFWYKEDKRLSDSWRG---VKVENRETISRVTFLNVSEQDYGNYT 295

  Fly   227 C-----------------------SPSSSDSASVVVHVINGEHPAAMQHGNSSAT 258
            |                       ||...:.::..:..:.|  |.|:..|||.:|
 Frog   296 CMAKNLLGHSNASIILFELFQSTSSPLLQEESTAALTPLKG--PGAVHDGNSGST 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 29/92 (32%)
IG_like 53..145 CDD:214653 29/91 (32%)
ig 153..227 CDD:278476 22/158 (14%)
IG_like 161..>227 CDD:214653 22/149 (15%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 29/93 (31%)
IG_like 45..133 CDD:214653 29/93 (31%)
IG_like 143..220 CDD:214653 7/76 (9%)
IGc2 150..209 CDD:197706 7/58 (12%)
ig 227..311 CDD:278476 15/86 (17%)
IG_like 230..311 CDD:214653 15/83 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.