DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and iglon5

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:366 Identity:81/366 - (22%)
Similarity:125/366 - (34%) Gaps:147/366 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLG 73
            :|.::.:|.|..:||:.|...   |||           .||     .|.:.|..|.|.|.:.:..
 Frog     9 SLASLGIVMLAQVLFVQCTEF---VPP-----------ADN-----YTVSQGDNATLSCLIDDKV 54

  Fly    74 DRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE--PK 136
            .| |:|:.:.  :||..|...::.|.|.|.|.:..| |:::.|:.....|.|.|.|...||  |.
 Frog    55 TR-VAWLNRS--NILYAGKDKWSIDSRVQLLTNTKS-EYSIVITHVDVADEGLYTCSFQTEDKPH 115

  Fly   137 ISQGFRLNVVVSRAKILG-NAELFIKSGSDINLTCLAM--------------------------- 173
            .||.:.  :|...|||:. ::.:.:..||::||.|||:                           
 Frog   116 TSQVYL--IVQVPAKIVNISSSVTVNEGSNVNLQCLAVGKPEPTITWQQLSEGFSSEGELLEITE 178

  Fly   174 -----------------------------------------QSP-------------VPPSFIYW 184
                                                     |||             |||:...|
 Frog   179 INRQQAGDYECVTSNGVSVPDTKKVQITVNYPPYITDVKNAQSPVGRPATLRCKAMAVPPAEFEW 243

  Fly   185 YKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAA 249
            ||.::....|...|:::.||.|  .|.::.:..|....|||||..|:.                 
 Frog   244 YKDEKRRLISGTEGLSIKTESS--WSVIVFSNVTSRHYGNYTCLASNK----------------- 289

  Fly   250 MQHGNSSATCLRP-------------------LSSTSVPFV 271
            :...|||...|:|                   ||||.:|.:
 Frog   290 LGSFNSSLRLLKPGDPLNQGATHMVSPLLLGLLSSTLIPLL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 27/94 (29%)
IG_like 53..145 CDD:214653 27/93 (29%)
ig 153..227 CDD:278476 26/155 (17%)
IG_like 161..>227 CDD:214653 26/146 (18%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 31/113 (27%)
IG_like 35..123 CDD:214653 28/98 (29%)
Ig 126..207 CDD:299845 10/80 (13%)
I-set 128..207 CDD:254352 9/78 (12%)
I-set 210..299 CDD:254352 25/107 (23%)
Ig 227..298 CDD:143165 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.