Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002938252.1 | Gene: | iglon5 / 100488314 | XenbaseID: | XB-GENE-945713 | Length: | 333 | Species: | Xenopus tropicalis |
Alignment Length: | 366 | Identity: | 81/366 - (22%) |
---|---|---|---|
Similarity: | 125/366 - (34%) | Gaps: | 147/366 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 ALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLG 73
Fly 74 DRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE--PK 136
Fly 137 ISQGFRLNVVVSRAKILG-NAELFIKSGSDINLTCLAM--------------------------- 173
Fly 174 -----------------------------------------QSP-------------VPPSFIYW 184
Fly 185 YKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAA 249
Fly 250 MQHGNSSATCLRP-------------------LSSTSVPFV 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 27/94 (29%) |
IG_like | 53..145 | CDD:214653 | 27/93 (29%) | ||
ig | 153..227 | CDD:278476 | 26/155 (17%) | ||
IG_like | 161..>227 | CDD:214653 | 26/146 (18%) | ||
iglon5 | XP_002938252.1 | Ig | 31..123 | CDD:299845 | 31/113 (27%) |
IG_like | 35..123 | CDD:214653 | 28/98 (29%) | ||
Ig | 126..207 | CDD:299845 | 10/80 (13%) | ||
I-set | 128..207 | CDD:254352 | 9/78 (12%) | ||
I-set | 210..299 | CDD:254352 | 25/107 (23%) | ||
Ig | 227..298 | CDD:143165 | 22/89 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |