DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:350 Identity:74/350 - (21%)
Similarity:126/350 - (36%) Gaps:108/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YSQPYFDNSSRREVTATVGQAALLHCRVRN---------------LGDRAVSWIRKRDLHILTVG 91
            :|.|.| :....:.:..:|:..:|.|.|.|               :|:...:|.|.|.|.|:.||
Zfish    22 FSGPRF-SQEPADQSVVIGERVVLSCVVFNYTGIVQWTKDGLALGIGEDLRAWPRYRVLRIMDVG 85

  Fly    92 ILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV--SRAKILG 154
                               ::.|.|:|....|...||||.:.....|:..:|.|::  ....|.|
Zfish    86 -------------------QYNLEITSADLTDDSLYECQATEAALRSRRAKLTVLIPPDGPVIEG 131

  Fly   155 NAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSK-LLIAKAT 218
            :.|:.:.:|:..||||:: :...|.|.|.|||...::. .......|:::|...|:| .|..:..
Zfish   132 SPEILLTAGTSFNLTCVS-RGAKPMSTIEWYKDGIIVE-GAHTSTEVLSDRKRVTTKSFLEIQPM 194

  Fly   219 PADSG-NYTCSPSS-------SDSASVVVH-------------VINGE----------HPAAM-- 250
            ..|:| |:||..|:       ..:.::.:|             |:.||          :|..|  
Zfish   195 DTDTGRNFTCVASNLAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATANPPIMGY 259

  Fly   251 ---------------------QHG--NSSATCL--RPLSSTSV---------PFVLATWMSMTVA 281
                                 .|.  ....:||  ..:.||:|         |.::.....:|| 
Zfish   260 RWAKGGVILDGARESVFETTADHSFFTEPVSCLVFNAVGSTNVSILVDVHFGPILVVEPRPVTV- 323

  Fly   282 SVAWNSNLNINWNWSPDWRWHWNPK 306
            .|..:..||..|:.:|.....|..|
Zfish   324 DVDSDVTLNCKWSGNPPLTLTWTKK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 23/107 (21%)
IG_like 53..145 CDD:214653 23/106 (22%)
ig 153..227 CDD:278476 21/75 (28%)
IG_like 161..>227 CDD:214653 19/67 (28%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.