| Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009305418.1 | Gene: | lrit3b / 100144406 | ZFINID: | ZDB-GENE-070424-130 | Length: | 487 | Species: | Danio rerio |
| Alignment Length: | 236 | Identity: | 52/236 - (22%) |
|---|---|---|---|
| Similarity: | 79/236 - (33%) | Gaps: | 42/236 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 WTTDCP-RALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYS--------QPYFDNSSRREVTA 57
Fly 58 TVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPR 122
Fly 123 ----------------DSGTYECQVSTEPKISQG-FRLNVVVSRAKILGNAELFIKSGSDINLTC 170
Fly 171 LAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSK 211 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 24/109 (22%) |
| IG_like | 53..145 | CDD:214653 | 23/108 (21%) | ||
| ig | 153..227 | CDD:278476 | 10/59 (17%) | ||
| IG_like | 161..>227 | CDD:214653 | 10/51 (20%) | ||
| lrit3b | XP_009305418.1 | LRRNT | 51..92 | CDD:214470 | |
| leucine-rich repeat | 69..89 | CDD:275380 | |||
| LRR_8 | 112..172 | CDD:290566 | |||
| leucine-rich repeat | 114..137 | CDD:275378 | |||
| leucine-rich repeat | 138..161 | CDD:275378 | |||
| LRR_8 | 160..214 | CDD:290566 | |||
| LRR_4 | 160..201 | CDD:289563 | |||
| leucine-rich repeat | 162..185 | CDD:275378 | |||
| leucine-rich repeat | 186..199 | CDD:275378 | |||
| leucine-rich repeat | 215..230 | CDD:275378 | 1/1 (100%) | ||
| Ig | 278..391 | CDD:299845 | 26/117 (22%) | ||
| I-set | 279..391 | CDD:254352 | 26/116 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||