Sequence 1: | NP_001014616.2 | Gene: | dpr4 / 3346160 | FlyBaseID: | FBgn0053512 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009305418.1 | Gene: | lrit3b / 100144406 | ZFINID: | ZDB-GENE-070424-130 | Length: | 487 | Species: | Danio rerio |
Alignment Length: | 236 | Identity: | 52/236 - (22%) |
---|---|---|---|
Similarity: | 79/236 - (33%) | Gaps: | 42/236 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 WTTDCP-RALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYS--------QPYFDNSSRREVTA 57
Fly 58 TVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPR 122
Fly 123 ----------------DSGTYECQVSTEPKISQG-FRLNVVVSRAKILGNAELFIKSGSDINLTC 170
Fly 171 LAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSK 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr4 | NP_001014616.2 | V-set | 53..146 | CDD:284989 | 24/109 (22%) |
IG_like | 53..145 | CDD:214653 | 23/108 (21%) | ||
ig | 153..227 | CDD:278476 | 10/59 (17%) | ||
IG_like | 161..>227 | CDD:214653 | 10/51 (20%) | ||
lrit3b | XP_009305418.1 | LRRNT | 51..92 | CDD:214470 | |
leucine-rich repeat | 69..89 | CDD:275380 | |||
LRR_8 | 112..172 | CDD:290566 | |||
leucine-rich repeat | 114..137 | CDD:275378 | |||
leucine-rich repeat | 138..161 | CDD:275378 | |||
LRR_8 | 160..214 | CDD:290566 | |||
LRR_4 | 160..201 | CDD:289563 | |||
leucine-rich repeat | 162..185 | CDD:275378 | |||
leucine-rich repeat | 186..199 | CDD:275378 | |||
leucine-rich repeat | 215..230 | CDD:275378 | 1/1 (100%) | ||
Ig | 278..391 | CDD:299845 | 26/117 (22%) | ||
I-set | 279..391 | CDD:254352 | 26/116 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |