DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr4 and negr1

DIOPT Version :9

Sequence 1:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:361 Identity:72/361 - (19%)
Similarity:110/361 - (30%) Gaps:145/361 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGD 74
            |...||:|       .| :..|:.....|      |..||...|:     |:.|:|.|.:.. |.
 Frog    23 LSLCCLLP-------SC-LPAGQSMDFQW------PAVDNLVVRQ-----GETAMLRCFLEE-GA 67

  Fly    75 RAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTE--PKI 137
            ...:|:.:..  |:..|...::.|.|. |:.:....|::|||......|.|.|.|.|.||  |:.
 Frog    68 SKGAWLNRSS--IIFAGGDKWSVDPRV-SIATSSKQEYSLRIQKVDVSDDGPYTCSVQTEHSPRT 129

  Fly   138 SQGFRLNVVVSRAKILG-NAELFIKSGSDINLTCLAMQSP------------------------- 176
            .| ..|.|.|| .||.. ::::.:..|::::|.|||...|                         
 Frog   130 LQ-VHLTVHVS-PKIYDISSDMTVNEGTNVSLICLATGKPEPSISWRHISPSAKQFGSGQYLDIY 192

  Fly   177 ----------------------------------------------------------VPPSFIY 183
                                                                      ||.....
 Frog   193 GITRDQAGDYECSAENDVSFPDVKKVKVTVNFAPTILEITPTGVSLGRTGLIRCETAAVPAPVFE 257

  Fly   184 WYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTC--------------------- 227
            ||||::.:...|||   :..:.....|.|.::..|....|||||                     
 Frog   258 WYKGEKKLTNGQRG---IRIQNYNTRSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEP 319

  Fly   228 ---SPSSSDSASVVVHVINGEH-------PAAMQHG 253
               ||.:|.:...|.|......       |:..|:|
 Frog   320 STTSPVTSSAKYSVKHYARSSSDKPHYAAPSTAQYG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr4NP_001014616.2 V-set 53..146 CDD:284989 26/94 (28%)
IG_like 53..145 CDD:214653 26/93 (28%)
ig 153..227 CDD:278476 21/157 (13%)
IG_like 161..>227 CDD:214653 21/148 (14%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 29/101 (29%)
FR1 44..62 CDD:409353 7/22 (32%)
Ig strand A' 47..53 CDD:409353 2/5 (40%)
Ig strand B 55..63 CDD:409353 3/7 (43%)
CDR1 63..68 CDD:409353 1/5 (20%)
FR2 69..75 CDD:409353 1/5 (20%)
Ig strand C 69..74 CDD:409353 1/4 (25%)
CDR2 76..87 CDD:409353 2/12 (17%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 11/34 (32%)
Ig strand D 91..98 CDD:409353 2/7 (29%)
Ig strand E 101..107 CDD:409353 3/5 (60%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 2/3 (67%)
Ig strand G 127..136 CDD:409353 3/9 (33%)
FR4 129..136 CDD:409353 2/7 (29%)
Ig_3 140..208 CDD:404760 8/67 (12%)
Ig strand A' 146..151 CDD:409353 0/4 (0%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 0/4 (0%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 0/5 (0%)
Ig strand F 200..207 CDD:409353 0/6 (0%)
Ig strand G 214..222 CDD:409353 0/7 (0%)
Ig_3 226..302 CDD:404760 17/78 (22%)
putative Ig strand A 226..232 CDD:409353 0/5 (0%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 2/3 (67%)
Ig strand F 295..300 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.