DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment upd3 and upd1

DIOPT Version :9

Sequence 1:NP_001097014.1 Gene:upd3 / 3346149 FlyBaseID:FBgn0053542 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001097015.1 Gene:upd1 / 32813 FlyBaseID:FBgn0004956 Length:413 Species:Drosophila melanogaster


Alignment Length:381 Identity:98/381 - (25%)
Similarity:159/381 - (41%) Gaps:81/381 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LILLA-----LAMSQFALSGGGCGVSAAPSHLATPPTDSPSS---------PINPTNPLKHLQKR 102
            ::|||     ||..:...|.||..|..: ..|....|.|.:|         |.:..:|    :||
  Fly    14 VLLLAAQLPHLAEGRSTTSSGGLTVIDS-ERLRIRTTSSTASAQHPNQGTIPASAASP----RKR 73

  Fly   103 SRAANFRLTFQQKLNASSTHLDWENTC--NLKPTGLNETHSKAKRCKKRQRILQNLQNQTGRELR 165
            .|..|......:..:.::|.|:|.|.|  |..|:    ...:..|.:.||...| |:....||.|
  Fly    74 HRKRNSNWIDYRNFDENTTALEWANPCGGNYHPS----AGDRFNRQRPRQSFNQ-LKRHAFREYR 133

  Fly   166 GI-QAEDKARITTNADKLATVSTKTLDIVEKNKWRFYKGNYRFLPRLNLTSKQLNLRHAHRDLQI 229
            .: .::|.|                :||.....|..:..||:|||:|...| .:.|:..:|::|.
  Fly   134 SLNSSQDSA----------------IDIRNMTMWSLHTHNYKFLPKLKPNS-TIALKRWYRNMQT 181

  Fly   230 YVGAFTYMRNIKLHWDLANLQAKSVLSDELGRMRKSAREVLCSVEEAINLTNLLYTPNRQRAPQP 294
            ||.:|.|:|..::.||..::..:|..:.||..:..|:|.:||.:|.|:|.|.           .|
  Fly   182 YVASFAYLRRQQIRWDQRSITRESSTARELRELLLSSRRILCELETAVNQTQ-----------SP 235

  Fly   295 RGQKKRRQAQPVVTY-------KILP---RKLMEKRLQQFNSTLVP-LVELHQQATLAARGEDVP 348
            | ||:||....|...       :.||   |..|.|||:..:.|..| :......|::||...|  
  Fly   236 R-QKQRRSGAAVTAVGGTTMLGQQLPQISRLEMNKRLKLRSKTSGPGMGGAASSASMAAGEAD-- 297

  Fly   349 PPPDDLMVLEQHALFTKLKFVQYLKSIRKILANQRKSL-CKATTHVPK--AIQKKL 401
              ..|:..::.|       :..:|:::.::|....|.: .:...|..|  ..||||
  Fly   298 --SIDMRFVKHH-------YYDFLRTMYQLLRRDGKRVRSRPRKHHKKQQRSQKKL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
upd3NP_001097014.1 Unpaired 100..393 CDD:292594 77/307 (25%)
upd1NP_001097015.1 Unpaired 71..333 CDD:292594 77/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F77T
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.