DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and HAND2

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_068808.1 Gene:HAND2 / 9464 HGNCID:4808 Length:217 Species:Homo sapiens


Alignment Length:106 Identity:42/106 - (39%)
Similarity:54/106 - (50%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NYLMAVFAQDSNSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINARERYRTFN 76
            :|.||:    |.|...|||   ||..:.|..|......|....|..|....|...|.:||.||.:
Human    57 DYSMAL----SYSPEYASG---AAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQS 114

  Fly    77 VNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTL 117
            :|||:..||..||..|.:.|||||:.:|||:|||.:|...|
Human   115 INSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 26/51 (51%)
HAND2NP_068808.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 11/39 (28%)
bHLH_TS_HAND2 100..161 CDD:381477 27/56 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149583
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.