DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and BHLHA9

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001157877.1 Gene:BHLHA9 / 727857 HGNCID:35126 Length:235 Species:Homo sapiens


Alignment Length:127 Identity:39/127 - (30%)
Similarity:49/127 - (38%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASGSG-----AAADSEDSQIGQEANPGG-----------------QENQGNHRRRPPRQK----- 65
            |.|.|     .|.||.:...|....|||                 :|..|..|.||.|.|     
Human     5 APGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMA 69

  Fly    66 INARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTECQ-PC 126
            .|.|||.|..:.|.|:.|||..:..:...::||||..:|.|...|..||..|......: ||
Human    70 ANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPC 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 20/51 (39%)
BHLHA9NP_001157877.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 17/63 (27%)
HLH 66..117 CDD:278439 17/50 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..235 39/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.