DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Tcf23

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_006504158.1 Gene:Tcf23 / 69852 MGIID:1934960 Length:216 Species:Mus musculus


Alignment Length:71 Identity:28/71 - (39%)
Similarity:41/71 - (57%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PGGQENQGN-HRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYIT 111
            |.|...:|. |.|.....:..||||.|...:..|:.||:..:|..|.:.||||::::.||:|||.
Mouse    61 PRGTRARGTAHGRSEASPENAARERTRVKTLRQAFLALQAALPAVPPDTKLSKLDVLVLATSYIA 125

  Fly   112 HLSSTL 117
            ||:.||
Mouse   126 HLTRTL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 23/51 (45%)
Tcf23XP_006504158.1 bHLH_TS_TCF23_OUT 77..132 CDD:381552 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839641
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.