powered by:
Protein Alignment CG33557 and Tcf23
DIOPT Version :9
Sequence 1: | NP_001014730.1 |
Gene: | CG33557 / 3346145 |
FlyBaseID: | FBgn0053557 |
Length: | 150 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006504158.1 |
Gene: | Tcf23 / 69852 |
MGIID: | 1934960 |
Length: | 216 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 28/71 - (39%) |
Similarity: | 41/71 - (57%) |
Gaps: | 1/71 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 PGGQENQGN-HRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYIT 111
|.|...:|. |.|.....:..||||.|...:..|:.||:..:|..|.:.||||::::.||:|||.
Mouse 61 PRGTRARGTAHGRSEASPENAARERTRVKTLRQAFLALQAALPAVPPDTKLSKLDVLVLATSYIA 125
Fly 112 HLSSTL 117
||:.||
Mouse 126 HLTRTL 131
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167839641 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.