DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and TCF15

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_004600.3 Gene:TCF15 / 6939 HGNCID:11627 Length:199 Species:Homo sapiens


Alignment Length:146 Identity:60/146 - (41%)
Similarity:77/146 - (52%) Gaps:19/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SNSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPP------RQKINARERYRTFNVNSA 80
            |.|..|....|.....|.::.|  ..|||....|......|      ||..|||||.||.:||:|
Human    29 SESDASDQSFGCCEGPEAARRG--PGPGGGRRAGGGGGAGPVVVVRQRQAANARERDRTQSVNTA 91

  Fly    81 YEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTL---ETGTECQPCLLHKYESEGIT----- 137
            :.|||.||||||::|||||||.:|||||||.||::.|   ::..:.|||......::|..     
Human    92 FTALRTLIPTEPVDRKLSKIETVRLASSYIAHLANVLLLGDSADDGQPCFRAAGSAKGAVPAAAD 156

  Fly   138 ---RRISICTFCLKTK 150
               :..|||||||..:
Human   157 GGRQPRSICTFCLSNQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 36/54 (67%)
TCF15NP_004600.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..67 10/39 (26%)
bHLH_TS_TCF15_paraxis 66..131 CDD:381476 39/64 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149599
Domainoid 1 1.000 74 1.000 Domainoid score I9147
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5122
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 1 1.000 - - otm40367
orthoMCL 1 0.900 - - OOG6_107399
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1534
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.