DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Scx

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001123980.1 Gene:Scx / 680712 RGDID:1588254 Length:209 Species:Rattus norvegicus


Alignment Length:195 Identity:67/195 - (34%)
Similarity:91/195 - (46%) Gaps:50/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVSSSSSSFSNYL---MAVFAQDSNSSGSASGSGAAADSEDSQI--------GQEANPGGQE--- 52
            |:..|:.....||   ::..::|.:....:|||    |.:..::        |.....||:.   
  Rat     4 AMLRSAPPPGRYLYPEVSPLSEDEDRGSESSGS----DEKPCRVHAARCGLQGARRRAGGRRAAG 64

  Fly    53 ---NQGNHRRRPPRQK--INARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITH 112
               ..|....|.|||:  .|||||.||.:||:|:.|||.||||||.:|||||||.:|||||||:|
  Rat    65 SGPGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISH 129

  Fly   113 LSSTLETGTEC---QPC-----LLHKYES-----------------EG--ITRRISICTFCLKTK 150
            |.:.|..|..|   |||     ..|...:                 :|  .|:...||||||..:
  Rat   130 LGNVLLVGEACGDGQPCHSGPAFFHSGRAGSPLPPPPPPPPLPLARDGGENTQPKQICTFCLSNQ 194

  Fly   151  150
              Rat   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 36/51 (71%)
ScxNP_001123980.1 bHLH_TS_scleraxis 76..143 CDD:381521 41/66 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343475
Domainoid 1 1.000 74 1.000 Domainoid score I8912
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 1 1.000 - - otm44500
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1534
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.