powered by:
Protein Alignment CG33557 and Ascl4
DIOPT Version :9
Sequence 1: | NP_001014730.1 |
Gene: | CG33557 / 3346145 |
FlyBaseID: | FBgn0053557 |
Length: | 150 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001157086.1 |
Gene: | Ascl4 / 67341 |
MGIID: | 1914591 |
Length: | 144 |
Species: | Mus musculus |
Alignment Length: | 75 |
Identity: | 31/75 - (41%) |
Similarity: | 37/75 - (49%) |
Gaps: | 15/75 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 RRRP-----------P---RQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASS 108
|||| | ||: |.|||.|...||..|..||..:|.|...::|||:|.:|.|.|
Mouse 43 RRRPYSSLPLGGVAEPAFLRQR-NERERQRVRCVNEGYARLRQHLPRELAGQRLSKVETLRAAIS 106
Fly 109 YITHLSSTLE 118
||..|...||
Mouse 107 YIKQLQELLE 116
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33557 | NP_001014730.1 |
HLH |
67..119 |
CDD:197674 |
24/52 (46%) |
Ascl4 | NP_001157086.1 |
HLH |
72..116 |
CDD:197674 |
17/43 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.