DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Ascl4

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001157086.1 Gene:Ascl4 / 67341 MGIID:1914591 Length:144 Species:Mus musculus


Alignment Length:75 Identity:31/75 - (41%)
Similarity:37/75 - (49%) Gaps:15/75 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RRRP-----------P---RQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASS 108
            ||||           |   ||: |.|||.|...||..|..||..:|.|...::|||:|.:|.|.|
Mouse    43 RRRPYSSLPLGGVAEPAFLRQR-NERERQRVRCVNEGYARLRQHLPRELAGQRLSKVETLRAAIS 106

  Fly   109 YITHLSSTLE 118
            ||..|...||
Mouse   107 YIKQLQELLE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/52 (46%)
Ascl4NP_001157086.1 HLH 72..116 CDD:197674 17/43 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.