DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and scxb

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_021328670.1 Gene:scxb / 567817 ZFINID:ZDB-GENE-090806-1 Length:200 Species:Danio rerio


Alignment Length:169 Identity:66/169 - (39%)
Similarity:80/169 - (47%) Gaps:47/169 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSNSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRR-------------------PPRQKI 66
            |.|.|   .|||    |||......::..|....|..::|                   ..|...
Zfish    25 DDNGS---EGSG----SEDKSFRTSSHGYGSFKLGVRKKRYSCRPLAIPTELCTPITEVRQRNTA 82

  Fly    67 NARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTEC---QPC-- 126
            |||||.||.:||:|:.|||.||||||.:|||||||.:|||||||:||.:.|..|.||   |||  
Zfish    83 NARERERTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEECGDGQPCLR 147

  Fly   127 ----LLHKY-----------ESEGITRRISICTFCLKTK 150
                |.|.:           :||....| .||||||..:
Zfish   148 SSGSLFHHHHNVSKSSTPSPDSENSQPR-QICTFCLSNQ 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 36/51 (71%)
scxbXP_021328670.1 HLH 78..129 CDD:306515 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583738
Domainoid 1 1.000 73 1.000 Domainoid score I9181
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 1 1.000 - - otm25997
orthoMCL 1 0.900 - - OOG6_107399
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5068
SonicParanoid 1 1.000 - - X1534
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.