DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and ATOH1

DIOPT Version :10

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_005163.1 Gene:ATOH1 / 474 HGNCID:797 Length:354 Species:Homo sapiens


Alignment Length:123 Identity:41/123 - (33%)
Similarity:60/123 - (48%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSGSASGS-----------------GAAADSEDSQIG--QEANPGGQENQGNHRRRPPRQKINAR 69
            |||.||.|                 |...|    ::|  ::..|..::..|..::|  |...|||
Human   109 SSGGASSSKSPGPVKVREQLCKLKGGVVVD----ELGCSRQRAPSSKQVNGVQKQR--RLAANAR 167

  Fly    70 ERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLET--GTECQP 125
            ||.|...:|.|::.|||:||:...::||||.|.:::|..||..||..|:|  |.|..|
Human   168 ERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 bHLH_TS_scleraxis_like 63..117 CDD:381471 24/53 (45%)
ATOH1NP_005163.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 6/12 (50%)
bHLH_TS_ATOH1 155..218 CDD:381556 27/64 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..277 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..354
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.