DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Fer2

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster


Alignment Length:144 Identity:43/144 - (29%)
Similarity:68/144 - (47%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NSSGSASGSGAAADSEDSQIGQEANPG----GQENQGNHRRRPPRQKINARER----------YR 73
            ::|.|..|.|.|..:.....| ..|||    |.....:::.:  ||..|.|||          |.
  Fly   108 SASSSGGGCGNAGSATPGGAG-GPNPGYGSVGAATASSYKMQ--RQAANVRERKRIQRSAPTGYT 169

  Fly    74 TFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETG----TECQPCLLHK---- 130
            ..::|||::.||..:||.|..::||||:.:|||.:||:.|...|:|.    |..:.||..:    
  Fly   170 KCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVEKCLRGEIKAD 234

  Fly   131 ---YESEGITRRIS 141
               :.:..:|.|:|
  Fly   235 RANWNTSDLTARLS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/61 (39%)
Fer2NP_001287359.1 HLH 148..210 CDD:278439 24/63 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452824
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.