DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and cato

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster


Alignment Length:161 Identity:43/161 - (26%)
Similarity:61/161 - (37%) Gaps:51/161 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SNYLMAVFAQDSNS----------------SGSASGSGA----------AADSEDSQIGQEANPG 49
            |.|..:...:|.:|                ||...|.||          ||....:::|......
  Fly     2 SYYYSSASEEDGSSQYLGSPNYNLTQLPPVSGQDYGQGAFLSPEWQFLDAAGGTQTELGPIMEAQ 66

  Fly    50 GQENQGNHRRRP-------------------------PRQKINARERYRTFNVNSAYEALRNLIP 89
            ||..|...:||.                         .||..|||||.|...:|:|:|.||.::|
  Fly    67 GQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLREVVP 131

  Fly    90 TEPMNRKLSKIEIIRLASSYITHLSSTLETG 120
            ...:::||||.|.:::|.|||..|...|..|
  Fly   132 APSIDQKLSKFETLQMAQSYILALCDLLNNG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 23/51 (45%)
catoNP_477344.1 HLH 104..155 CDD:278439 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.