DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Ferd3l

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001102450.1 Gene:Ferd3l / 366598 RGDID:1311812 Length:166 Species:Rattus norvegicus


Alignment Length:105 Identity:35/105 - (33%)
Similarity:54/105 - (51%) Gaps:20/105 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GAAADSEDSQIGQEANPGGQENQGNHR-----RRPPRQKI---------NARERYRTFNVNSAYE 82
            |...|.||.:..:|      |.:|..|     .||.|:::         |.|||.|.||:|.|::
  Rat    64 GGEVDYEDPEEEEE------EGEGRGRVASLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFD 122

  Fly    83 ALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTE 122
            .||..:||....::||:||.:|||..||:.::..|::..|
  Rat   123 QLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 23/51 (45%)
Ferd3lNP_001102450.1 HLH 102..154 CDD:278439 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.