DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Bhlha9

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_038943763.1 Gene:Bhlha9 / 363656 RGDID:1311234 Length:230 Species:Rattus norvegicus


Alignment Length:82 Identity:30/82 - (36%)
Similarity:39/82 - (47%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QENQGNHRRRPPRQK-----INARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYI 110
            :|..|..|.||.|.|     .|.|||.|..:.|.|:.|||..:..:...::||||..:|.|...|
  Rat    45 EEVAGRKRERPARSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKIATLRRAIHRI 109

  Fly   111 THLSSTLETGTECQ-PC 126
            |.||..|......: ||
  Rat   110 TALSLVLRASPAPRWPC 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 21/51 (41%)
Bhlha9XP_038943763.1 bHLH_TS_bHLHa9 54..116 CDD:381482 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.