DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and msgn1

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_878302.1 Gene:msgn1 / 360135 ZFINID:ZDB-GENE-030722-1 Length:131 Species:Danio rerio


Alignment Length:105 Identity:31/105 - (29%)
Similarity:46/105 - (43%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSNSSGSASGSGAAADSEDSQIGQEANPGGQENQG-----NHRRRPPRQKINARERYRTFNVNSA 80
            ||.||..:....:|..|.|::....|.....|.|.     :.||   |.|.:.||:.|..::..|
Zfish    28 DSASSPESESFDSACSSPDARSSPTAGCEHAEQQKPKVKMSMRR---RMKASEREKLRMRSLAEA 89

  Fly    81 YEALRNLIPTEPMNR--KLSKIEIIRLASSYITHLSSTLE 118
            ...||:.:|.....|  .|:||:.::....||..||..||
Zfish    90 LHQLRDYLPPGYSRRGQPLTKIQTLKYTIQYIKELSGILE 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 17/54 (31%)
msgn1NP_878302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..79 14/53 (26%)
HLH 71..124 CDD:278439 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.