DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and bhlha9

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001189344.1 Gene:bhlha9 / 323481 ZFINID:ZDB-GENE-030131-2201 Length:260 Species:Danio rerio


Alignment Length:127 Identity:38/127 - (29%)
Similarity:54/127 - (42%) Gaps:25/127 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSGSASGSGAAADSED-----SQIGQEANPGG----QENQGNHRRRPPRQK-----INARERYRT 74
            |.||.:||..:.:..|     |::......||    :|.....|.||.|.|     .|.|||.|.
Zfish    13 SRGSFTGSEFSEEEPDGSLQESELDSSDGLGGLNEPEERLIKKRSRPVRSKARRVAANVRERKRI 77

  Fly    75 FNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETG-----------TECQP 125
            .:.|.|:.|||..:..:...::||||..::.|.:.|:.||..|...           .||||
Zfish    78 LDYNQAFNALRVALHHDLSGKRLSKIATLQRAINRISALSVFLTNNPPVGVAKPCGHLECQP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 19/51 (37%)
bhlha9NP_001189344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..49 6/31 (19%)
HLH 65..116 CDD:278439 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.