DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and HLH4C

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:102 Identity:37/102 - (36%)
Similarity:49/102 - (48%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GQENQGNHRRRPPRQKIN----ARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYI 110
            |...:...|||....|..    .|||.|....|.::..||.|:||.|.::|||||||::||..||
  Fly    93 GLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYI 157

  Fly   111 THLSSTLETGTECQPCLLHKYESEGITRRISICTFCL 147
            .:|:..|||          ..:|.|.:   |..|.||
  Fly   158 AYLNHVLET----------PXDSAGAS---SFATSCL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/55 (44%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.