DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and tal1

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_998402.1 Gene:tal1 / 30766 ZFINID:ZDB-GENE-980526-501 Length:324 Species:Danio rerio


Alignment Length:96 Identity:41/96 - (42%)
Similarity:52/96 - (54%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SGAAADSEDSQIGQ------EANPGGQE---NQGNHRRRPPRQKINARERYRTFNVNSAYEALRN 86
            ||.|.|:|  |.|.      :..|...|   |.|:..:...|...|:|||:|..|||.|:..||.
Zfish   148 SGFAGDAE--QYGMYPSNRVKRRPAPYEVEINDGSQPKIVRRIFTNSRERWRQQNVNGAFAELRK 210

  Fly    87 LIPTEPMNRKLSKIEIIRLASSYITHLSSTL 117
            ||||.|.::||||.||:|||..||..|:..|
Zfish   211 LIPTHPPDKKLSKNEILRLAMKYINFLAKLL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 29/51 (57%)
tal1NP_998402.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
HLH 191..241 CDD:197674 28/49 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.