DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Neurog2

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_008759703.1 Gene:Neurog2 / 295475 RGDID:1309061 Length:263 Species:Rattus norvegicus


Alignment Length:154 Identity:46/154 - (29%)
Similarity:62/154 - (40%) Gaps:56/154 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GSASG--------SGAAADSEDSQI-------GQEANPGGQENQGNH------------------ 57
            ||||.        |.:|.:.||.::       ||.....||..||:.                  
  Rat    21 GSASPASATLTPMSSSADEEEDEELRRPGAARGQRGAEAGQGVQGSSASGAGGCRPGRLLGLVHE 85

  Fly    58 -RRRPPRQ----------------------KINARERYRTFNVNSAYEALRNLIPTEPMNRKLSK 99
             :|||.|.                      |.|.|||.|..|:|:|.:|||.::||.|.:.||:|
  Rat    86 CKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK 150

  Fly   100 IEIIRLASSYITHLSSTLETGTEC 123
            ||.:|.|.:||..|:.||.....|
  Rat   151 IETLRFAHNYIWALTETLRLADHC 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 26/51 (51%)
Neurog2XP_008759703.1 HLH 110..169 CDD:238036 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5315
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.