DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Fer1

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:152 Identity:50/152 - (32%)
Similarity:71/152 - (46%) Gaps:34/152 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSSSSSFSNYLMAVFAQDSNSSGSASGSGAAADSEDSQIGQEANPGGQEN---------QGNHRR 59
            :::|:|.|:|    |..|.:||.|        |.||.......| ..|||         :.:|:.
  Fly    24 TNASTSSSDY----FFGDEHSSES--------DDEDDAYSSGFN-SDQENTEKTFCPFSRRSHKP 75

  Fly    60 R---------PPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSS 115
            |         ..||..|.|||.|..::|.|:|.||..|||.|..::|||::.::||.||||.||.
  Fly    76 RRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSE 140

  Fly   116 TL---ETGTECQPCLLHKYESE 134
            .:   :.|.|....|...|:.|
  Fly   141 MVKKDKNGNEPGLSLQRNYQKE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/54 (46%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452817
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.