DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Tcf21

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001027569.1 Gene:Tcf21 / 252856 RGDID:620523 Length:179 Species:Rattus norvegicus


Alignment Length:151 Identity:44/151 - (29%)
Similarity:64/151 - (42%) Gaps:29/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VSSSSSSFSNYLMAVFAQDSNSSGSASGSGAAADSEDSQIGQEANPGG-QENQG--NHRRRPPRQ 64
            :|:.|.|....|..|...|.:|....|.......:|.::.|.....|. |:.:|  ..||:.|.:
  Rat     1 MSTGSLSDVEDLQEVEMLDCDSLKVDSNKEFGTSNESTEEGSNCENGSPQKGRGGLGKRRKAPTK 65

  Fly    65 K-----------------INARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITH 112
            |                 .|||||.|...::.|:..|:..:|..|.:.||||::.:|||||||.|
  Rat    66 KSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAH 130

  Fly   113 LSSTLETGTECQPCLLHKYES 133
            |...|..         .|||:
  Rat   131 LRQILAN---------DKYEN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/51 (47%)
Tcf21NP_001027569.1 bHLH_TS_TCF21_capsulin 77..140 CDD:381547 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.