DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Scx

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_006520723.1 Gene:Scx / 20289 MGIID:102934 Length:232 Species:Mus musculus


Alignment Length:193 Identity:67/193 - (34%)
Similarity:91/193 - (47%) Gaps:48/193 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVSSSSSSFSNYL---MAVFAQDSNSSGSASGSGAAADSEDSQI--------GQEANPGGQE--- 52
            |:..|:.....||   ::..::|.:....:|||    |.:..::        |.....||:.   
Mouse     4 AMLRSAPPPGRYLYPEVSPLSEDEDRGSESSGS----DEKPCRVHAARCGLQGARRRAGGRRAAG 64

  Fly    53 ---NQGNHRRRPPRQK--INARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITH 112
               ..|....|.|||:  .|||||.||.:||:|:.|||.||||||.:|||||||.:|||||||:|
Mouse    65 SGPGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISH 129

  Fly   113 LSSTLETGTEC---QPC-----LLHKYES---------------EG--ITRRISICTFCLKTK 150
            |.:.|..|..|   |||     ..|...:               :|  .|:...||||||..:
Mouse   130 LGNVLLVGEACGDGQPCHSGPAFFHSGRAGSPLPPPPPPPPLARDGGENTQPKQICTFCLSNQ 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 36/51 (71%)
ScxXP_006520723.1 bHLH_TS_scleraxis 76..143 CDD:381521 41/66 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839653
Domainoid 1 1.000 74 1.000 Domainoid score I9121
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 1 1.000 - - otm42434
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5068
SonicParanoid 1 1.000 - - X1534
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.