DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Nhlh2

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_848892.1 Gene:Nhlh2 / 18072 MGIID:97324 Length:135 Species:Mus musculus


Alignment Length:135 Identity:44/135 - (32%)
Similarity:66/135 - (48%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVSSSSSSFSNYLMAVFAQDSNSSGSASGS--GAAADSE-------DSQIGQEA----NPGGQE 52
            |.:|...::.|::..:..: |..|.|.|...  |:.:|.|       |.:.|..|    :|....
Mouse     1 MMLSPDQAADSDHPSSTHS-DPESLGGADTKVLGSVSDLEPVEEADGDGKGGSRAALYPHPQQLS 64

  Fly    53 NQGNHRRRPPRQKINA----RERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHL 113
            .:...|||....|..:    |||.|....|.|:..||.|:||.|.::|||||||:|||..||::|
Mouse    65 REEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYL 129

  Fly   114 SSTLE 118
            :..|:
Mouse   130 NHVLD 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 26/56 (46%)
Nhlh2NP_848892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 18/80 (23%)
bHLH_TS_HEN2 63..135 CDD:381545 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5408
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.