DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Nhlh1

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_035046.1 Gene:Nhlh1 / 18071 MGIID:98481 Length:133 Species:Mus musculus


Alignment Length:123 Identity:41/123 - (33%)
Similarity:58/123 - (47%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSSSSSFSNYLMAVFAQDSNSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINA 68
            |.:.|.||:     ........|:.||.........|::|:......|......|||  |::..|
Mouse    17 SETESGFSD-----CGGGPGPDGAGSGDPGVVQVRSSELGESGRKDLQHLSREERRR--RRRATA 74

  Fly    69 --------RERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLE 118
                    |||.|....|.|:..||.|:||.|.::|||||||:|||..||::|:..|:
Mouse    75 KYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLD 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 27/60 (45%)
Nhlh1NP_035046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78 15/67 (22%)
HLH 77..127 CDD:306515 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5408
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.