DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Ascl1

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_032579.2 Gene:Ascl1 / 17172 MGIID:96919 Length:231 Species:Mus musculus


Alignment Length:141 Identity:36/141 - (25%)
Similarity:54/141 - (38%) Gaps:46/141 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSGSASGSGAAADSEDSQIGQEANPGGQENQ-----------GNH-------------------- 57
            ::.:|:.:.|||.::.:|..|...|..|..|           |.|                    
Mouse    30 ATAAAAAAAAAAAAQSAQQQQPQAPPQQAPQLSPVADSQPSGGGHKSAAKQVKRQRSSSPELMRC 94

  Fly    58 RRR----------PPRQ-----KINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLAS 107
            :||          |.:|     :.|.|||.|...||..:..||..:|....|:|:||:|.:|.|.
Mouse    95 KRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAV 159

  Fly   108 SYITHLSSTLE 118
            .||..|...|:
Mouse   160 EYIRALQQLLD 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 21/52 (40%)
Ascl1NP_032579.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..92 10/52 (19%)
HLH 129..171 CDD:197674 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.