DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Hand1

DIOPT Version :10

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus


Alignment Length:114 Identity:43/114 - (37%)
Similarity:64/114 - (56%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FSNYLM--AVFAQDSNSSG--SASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINA-- 68
            |.::|:  |..|.|..:.|  ..:...|||...|::..|  :||..|..|:   |.|::|.:.  
Mouse    42 FQSWLLSPADAAPDFPAGGPPPTTAVAAAAYGPDARPSQ--SPGRLEALGS---RLPKRKGSGPK 101

  Fly    69 RERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTL 117
            :||.||.::|||:..||..||..|.:.|||||:.:|||:|||.:|...|
Mouse   102 KERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 bHLH_TS_scleraxis_like 63..117 CDD:381471 25/55 (45%)
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 19/60 (32%)
bHLH_TS_HAND1 94..153 CDD:381522 26/57 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.