DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and Ferd3l

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_277057.1 Gene:Ferd3l / 114712 MGIID:2150010 Length:168 Species:Mus musculus


Alignment Length:101 Identity:33/101 - (32%)
Similarity:54/101 - (53%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EDSQIGQEANPGGQENQGNHR-------RRPPRQKI---------NARERYRTFNVNSAYEALRN 86
            |..::..| :|..:|.:|..|       .||.|:::         |.|||.|.||:|.|::.||.
Mouse    65 EGDEVEYE-DPEEEEEEGEGRGRVASLLGRPKRKRVITYAQRQAANIRERKRMFNLNEAFDQLRR 128

  Fly    87 LIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTE 122
            .:||....::||:||.:|||..||:.::..|::..|
Mouse   129 KVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 23/51 (45%)
Ferd3lNP_277057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88 6/23 (26%)
bHLH domain 104..159 22/54 (41%)
HLH 104..156 CDD:278439 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.