DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and ascl2

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_002940290.3 Gene:ascl2 / 100494131 XenbaseID:XB-GENE-6458615 Length:236 Species:Xenopus tropicalis


Alignment Length:139 Identity:42/139 - (30%)
Similarity:56/139 - (40%) Gaps:46/139 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SNSSGS--------ASGS-----GAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINARERYR 73
            :|.|||        .|||     |.:|.||                    ||      |.|||.|
 Frog    85 ANQSGSPQRLRCQRRSGSLPNAIGISATSE--------------------RR------NERERNR 123

  Fly    74 TFNVNSAYEALRNLIP-TEPMNRKLSKIEIIRLASSYITHLSSTL--ETGTECQPCLLHKYESEG 135
            ...||..:..||..:| .:..|:|:||:|.:|.|..||..|.|.|  .|..|.|    .:..|:|
 Frog   124 VKLVNLGFAKLRQHVPQAQGPNKKMSKVETLRSAVEYIRALQSILMERTAGEGQ----GRAGSDG 184

  Fly   136 ITRRISICT 144
            ::...|.|:
 Frog   185 LSPCGSSCS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 22/54 (41%)
ascl2XP_002940290.3 bHLH_TS_ASCL2_Mash2 110..174 CDD:381586 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.