DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and LOC100493338

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_002937913.2 Gene:LOC100493338 / 100493338 -ID:- Length:206 Species:Xenopus tropicalis


Alignment Length:147 Identity:63/147 - (42%)
Similarity:85/147 - (57%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSNSS--GSASGSGAAADSEDSQIGQEANPGG-----QENQGNHRRR-------PPRQKINARER 71
            |.|:.  ..|....:.:||.|..:| ..:.||     :|::|..:|:       ..||..|||||
 Frog    49 DCNNGLLSDAEDLESVSDSSDKSLG-GGDEGGCCSPAEESRGKRKRKSRLSGVSKQRQAANARER 112

  Fly    72 YRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTEC---QPCLLHKYES 133
            .||.:||:|:.|||.||||||.:|||||||.:|||||||:||::.|..|.:|   ||||.::...
 Frog   113 DRTHSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLANILLLGEDCMDGQPCLQYRSSM 177

  Fly   134 EGITRRISICTFCLKTK 150
            .....| .||||||..:
 Frog   178 ASAAPR-PICTFCLSNQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 36/51 (71%)
LOC100493338XP_002937913.2 bHLH_TS_scleraxis_like 104..158 CDD:381471 37/53 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8964
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4871
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 1 1.000 - - otm47539
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1534
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.