DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and neurog2

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_002934289.2 Gene:neurog2 / 100493110 XenbaseID:XB-GENE-491040 Length:213 Species:Xenopus tropicalis


Alignment Length:121 Identity:40/121 - (33%)
Similarity:55/121 - (45%) Gaps:22/121 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AQDSNSSGSASGSGAAADSEDSQIGQEANPG-------GQENQGNHRRRPPRQ------------ 64
            |...:.|.|.........|:|.|:....:|.       .|||....||..||.            
 Frog    18 ASPCSVSSSHMSPAQTCSSDDEQLLSPTSPALMHLQAQEQENSPPSRRSRPRTKNGETVLKVKKT 82

  Fly    65 ---KINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTL 117
               |.|.|||.|..::|||.::||.::|:.|.:.||:|||.:|.|.:||..||.||
 Frog    83 RRIKANNRERNRMHHLNSALDSLREVLPSLPEDAKLTKIETLRFAYNYIWALSETL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/51 (49%)
neurog2XP_002934289.2 bHLH_TS_NGN2_ATOH4 74..142 CDD:381560 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.