DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and tcf21

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001103518.1 Gene:tcf21 / 100126209 XenbaseID:XB-GENE-484805 Length:179 Species:Xenopus tropicalis


Alignment Length:127 Identity:41/127 - (32%)
Similarity:56/127 - (44%) Gaps:30/127 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AQDSNSSGS------------ASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINARER 71
            :.|||...|            .||....|.|:.|.:| ..|..|::.|        |...|||||
 Frog    34 SNDSNEESSTCDNGSPKKGRGTSGKRRKAPSKKSPLG-NINQEGKQVQ--------RNAANARER 89

  Fly    72 YRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTECQPCLLHKYES 133
            .|...::.|:..|:..:|..|.:.||||::.:|||||||.||...|..         .|||:
 Frog    90 ARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAN---------DKYEN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/51 (47%)
tcf21NP_001103518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..87 15/61 (25%)
bHLH_TS_TCF21_capsulin 77..140 CDD:381547 26/79 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.