DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and neurod1

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001090868.1 Gene:neurod1 / 100038290 XenbaseID:XB-GENE-963757 Length:361 Species:Xenopus tropicalis


Alignment Length:124 Identity:39/124 - (31%)
Similarity:58/124 - (46%) Gaps:17/124 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LMAVFAQDS--NSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPP-------------- 62
            ||....:||  :.:|..:......|.|:.:...:.:....::|...||.|.              
 Frog    44 LMKEDDEDSLNHHNGEENEEEDEVDDEEEEDDDDEDDEDDDDQKPKRRGPKKKKMTKARVERFKV 108

  Fly    63 -RQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETG 120
             |.|.|||||.|...:|:|.:.||.::|.....:||||||.:|||.:||..||..|.:|
 Frog   109 RRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/51 (49%)
neurod1NP_001090868.1 bHLH_TS_NeuroD1 82..167 CDD:381562 31/84 (37%)
Neuro_bHLH 167..288 CDD:372170 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.