DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and scxa

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001076538.2 Gene:scxa / 100034489 ZFINID:ZDB-GENE-060503-414 Length:204 Species:Danio rerio


Alignment Length:180 Identity:65/180 - (36%)
Similarity:86/180 - (47%) Gaps:42/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SNYL---MAVFAQDSNSSGSASGSGAAA-----DSEDSQIGQEANP---GGQENQGNHRRRP--- 61
            |.|:   :::.::|..:...:|||...:     ...|.::|::...   ||....|.....|   
Zfish    12 SRYVYSDISMMSEDDENGSESSGSDDRSFHLDTSGYDLKVGRKRKSSVGGGGRLIGVTPTIPTGT 76

  Fly    62 --------PRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLE 118
                    .|...|||||.||.:||:|:.|||.||||||.:|||||||.:|||||||:||.:.|.
Zfish    77 IGHVPEIRQRNAANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLL 141

  Fly   119 TGTEC---QPCLLHK--------YESEGITRRIS-------ICTFCLKTK 150
            .|..|   |||  |.        |...|...|.|       ||||||..:
Zfish   142 VGEACGDGQPC--HSGGPSTSNYYHHHGSPSRDSENSQPKQICTFCLSNQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 36/51 (71%)
scxaNP_001076538.2 HLH 85..136 CDD:278439 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583739
Domainoid 1 1.000 73 1.000 Domainoid score I9181
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 1 1.000 - - otm25997
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5068
SonicParanoid 1 1.000 - - X1534
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.