DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33557 and si:ch211-246m6.4

DIOPT Version :9

Sequence 1:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_001340709.1 Gene:si:ch211-246m6.4 / 100000527 ZFINID:ZDB-GENE-050208-498 Length:193 Species:Danio rerio


Alignment Length:155 Identity:63/155 - (40%)
Similarity:79/155 - (50%) Gaps:46/155 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSNSSGSASGSGAAADSEDSQIGQEANPGGQENQGN---HRRR---------PPRQKINARERYR 73
            ||.|..|...:||                |...:|:   .|||         ..||..|||||.|
Zfish    47 DSGSDSSEKSTGA----------------GSPTRGHREVRRRRGSRRLAGVSKQRQAANARERDR 95

  Fly    74 TFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTEC---QPCLLHKY---- 131
            |.:||:|:.:||.||||||.:|||||||.:|||||||:||::.|..|.:|   ||||  ||    
Zfish    96 THSVNTAFTSLRTLIPTEPADRKLSKIETLRLASSYISHLANVLLLGEDCRDGQPCL--KYHNIL 158

  Fly   132 ------ESEGITRRISICTFCLKTK 150
                  :|..:.   .||||||..:
Zfish   159 QSNANLKSPPVR---PICTFCLSNQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33557NP_001014730.1 HLH 67..119 CDD:197674 35/51 (69%)
si:ch211-246m6.4XP_001340709.1 HLH 84..135 CDD:278439 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583746
Domainoid 1 1.000 73 1.000 Domainoid score I9181
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 1 1.000 - - otm25997
orthoMCL 1 0.900 - - OOG6_107399
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1534
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.