DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33521 and WLIM2a

DIOPT Version :10

Sequence 1:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_181519.1 Gene:WLIM2a / 818577 AraportID:AT2G39900 Length:200 Species:Arabidopsis thaliana


Alignment Length:64 Identity:22/64 - (34%)
Similarity:35/64 - (54%) Gaps:6/64 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ENCHQCKKPVYKMEEVILSLKTATTI-FHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIF 140
            :.|..|:|.||.:|     |.:|..| :||.|.:|..|...|:..:|:..:|.:||..||:.:|
plant     8 QKCRACEKTVYPVE-----LLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLF 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 19/56 (34%)
WLIM2aNP_181519.1 LIM1_SF3 6..68 CDD:188824 22/64 (34%)
LIM2_SF3 109..169 CDD:188825
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.